Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.17: Cystatin-like [54402] (5 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (3 families) has a additional strand at the N-terminus |
Family d.17.1.2: Cystatins [54407] (5 proteins) |
Protein Cystatin A (stefin A) [54412] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54413] (9 PDB entries) |
Domain d1nb5k_: 1nb5 K: [80383] Other proteins in same PDB: d1nb5.1, d1nb5.2, d1nb5.3, d1nb5.4 |
PDB Entry: 1nb5 (more details), 2.4 Å
SCOP Domain Sequences for d1nb5k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nb5k_ d.17.1.2 (K:) Cystatin A (stefin A) {Human (Homo sapiens)} mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf
Timeline for d1nb5k_: