Lineage for d1nb5.1 (1nb5 P:,A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 252917Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 252918Superfamily d.3.1: Cysteine proteinases [54001] (9 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 252919Family d.3.1.1: Papain-like [54002] (19 proteins)
  6. 253016Protein Cathepsin H [81637] (1 species)
    also contains a disulfide-bound minicathepsin H chain
  7. 253017Species Pig (Sus scrofa) [TaxId:9823] [81636] (3 PDB entries)
  8. 253019Domain d1nb5.1: 1nb5 P:,A: [80377]
    Other proteins in same PDB: d1nb5i_, d1nb5j_, d1nb5k_, d1nb5l_

Details for d1nb5.1

PDB Entry: 1nb5 (more details), 2.4 Å

PDB Description: crystal structure of stefin a in complex with cathepsin h

SCOP Domain Sequences for d1nb5.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1nb5.1 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa)}
epqncsatXyppsmdwrkkgnfvspvknqgscgscwtfsttgalesavaiatgkmlslae
qqlvdcaqnfnnhgcqgglpsqafeyirynkgimgedtypykgqddhckfqpdkaiafvk
dvanitmndeeamveavalynpvsfafevtndflmyrkgiysstschktpdkvnhavlav
gygeengipywivknswgpqwgmngyfliergknmcglaacasypiplv

SCOP Domain Coordinates for d1nb5.1:

Click to download the PDB-style file with coordinates for d1nb5.1.
(The format of our PDB-style files is described here.)

Timeline for d1nb5.1: