Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (9 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (19 proteins) |
Protein Cathepsin H [81637] (1 species) also contains a disulfide-bound minicathepsin H chain |
Species Pig (Sus scrofa) [TaxId:9823] [81636] (3 PDB entries) |
Domain d1nb5.1: 1nb5 P:,A: [80377] Other proteins in same PDB: d1nb5i_, d1nb5j_, d1nb5k_, d1nb5l_ |
PDB Entry: 1nb5 (more details), 2.4 Å
SCOP Domain Sequences for d1nb5.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1nb5.1 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa)} epqncsatXyppsmdwrkkgnfvspvknqgscgscwtfsttgalesavaiatgkmlslae qqlvdcaqnfnnhgcqgglpsqafeyirynkgimgedtypykgqddhckfqpdkaiafvk dvanitmndeeamveavalynpvsfafevtndflmyrkgiysstschktpdkvnhavlav gygeengipywivknswgpqwgmngyfliergknmcglaacasypiplv
Timeline for d1nb5.1: