SCOP 1.63: Domain d1nb3l_: 1nb3 L:

Lineage for d1nb3l_ (1nb3 L:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (3 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (5 proteins)

6. Protein Cystatin A (stefin A) [54412] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54413] (9 PDB entries)

8. Domain d1nb3l_: 1nb3 L: [80376]
   Other proteins in same PDB: d1nb3.1, d1nb3.2, d1nb3.3, d1nb3.4
   complexed with bma, nag

Details for d1nb3l_

PDB Entry: 1nb3, 2.8 Å

PDB Description: crystal structure of stefin a in complex with cathepsin h: n-terminal residues of inhibitors can adapt to the active sites of endo-and exopeptidases

SCOP Domain Sequences for d1nb3l_:

Sequence; same for both SEQRES and ATOM records:

>d1nb3l_ d.17.1.2 (L:) Cystatin A (stefin A) {Human (Homo sapiens)}
mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf

Timeline for d1nb3l_:

• d1nb3l_ is new in SCOP 1.63
  
• d1nb3l_ appears in SCOP 1.65
  
• d1nb3l_ appears in the current release, SCOPe 2.08