SCOPe 2.05: Domain d1nb3j_: 1nb3 J:

Lineage for d1nb3j_ (1nb3 J:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (7 proteins)
   automatically mapped to Pfam PF00031

6. Protein Cystatin A (stefin A) [54412] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54413] (12 PDB entries)

8. Domain d1nb3j_: 1nb3 J: [80374]
   Other proteins in same PDB: d1nb3.1, d1nb3.2, d1nb3.3, d1nb3.4

Details for d1nb3j_

PDB Entry: 1nb3, 2.8 Å

PDB Description: crystal structure of stefin a in complex with cathepsin h: n-terminal residues of inhibitors can adapt to the active sites of endo-and exopeptidases

PDB Compounds: (J:) stefin a

SCOPe Domain Sequences for d1nb3j_:

Sequence; same for both SEQRES and ATOM records:

>d1nb3j_ d.17.1.2 (J:) Cystatin A (stefin A) {Human (Homo sapiens) [TaxId: 9606]}
mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf

Timeline for d1nb3j_:

• d1nb3j_ first appeared in SCOP 1.63
  
• d1nb3j_ appears in SCOPe 2.04
  
• d1nb3j_ appears in SCOPe 2.06
  
• d1nb3j_ appears in the current release, SCOPe 2.08