Lineage for d1naaa1 (1naa A:215-512,A:694-755)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1832683Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 1832716Protein Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain [82309] (1 species)
  7. 1832717Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [82310] (2 PDB entries)
  8. 1832720Domain d1naaa1: 1naa A:215-512,A:694-755 [80365]
    Other proteins in same PDB: d1naaa2, d1naab2
    complexed with 6fa, abl, nag

Details for d1naaa1

PDB Entry: 1naa (more details), 1.8 Å

PDB Description: cellobiose dehydrogenase flavoprotein fragment in complex with cellobionolactam
PDB Compounds: (A:) cellobiose dehydrogenase

SCOPe Domain Sequences for d1naaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1naaa1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
tpydyiivgagpggiiaadrlseagkkvlllerggpstkqtggtyvapwatssgltkfdi
pglfeslftdsnpfwwckditvfagclvgggtsvngalywypndgdfsssvgwpsswtnh
apytsklssrlpstdhpstdgqryleqsfnvvsqllkgqgynqatindnpnykdhvfgys
afdflngkragpvatylqtalarpnftfktnvmvsnvvrngsqilgvqtndptlgpngfi
pvtpkgrvilsagafgtsrilfqsgigptdmiqtvqsnptaaaalppqnqwinlpvgmXt
tigsspqsavvdsnvkvfgtnnlfivdagiiphlptgnpqgtlmsaaeqaaakilalagg
p

SCOPe Domain Coordinates for d1naaa1:

Click to download the PDB-style file with coordinates for d1naaa1.
(The format of our PDB-style files is described here.)

Timeline for d1naaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1naaa2