SCOPe 2.05: Domain d1n9sl_: 1n9s L:

Lineage for d1n9sl_ (1n9s L:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
   forms homo and heteroheptameric ring structures

6. Protein Small nuclear ribonucleoprotein F, Smf [82087] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82088] (2 PDB entries)

8. Domain d1n9sl_: 1n9s L: [80362]

Details for d1n9sl_

PDB Entry: 1n9s, 3.5 Å

PDB Description: crystal structure of yeast smf in spacegroup p43212

PDB Compounds: (L:) Small nuclear ribonucleoprotein F

SCOPe Domain Sequences for d1n9sl_:

Sequence; same for both SEQRES and ATOM records:

>d1n9sl_ b.38.1.1 (L:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vnpkpflkglvnhrvgvklkfnsteyrgtlvstdnyfnlqlneaeefvagvshgtlgeif
irsnnvlyirelpn

Timeline for d1n9sl_:

• d1n9sl_ first appeared in SCOP 1.63
  
• d1n9sl_ appears in SCOPe 2.04
  
• d1n9sl_ appears in SCOPe 2.06
  
• d1n9sl_ appears in the current release, SCOPe 2.08