Lineage for d1n9si_ (1n9s I:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296506Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 296507Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 296508Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (7 proteins)
    forms homo and heteroheptameric ring structures
  6. 296715Protein Small nuclear ribonucleoprotein F, Smf [82087] (1 species)
  7. 296716Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82088] (2 PDB entries)
  8. 296732Domain d1n9si_: 1n9s I: [80359]

Details for d1n9si_

PDB Entry: 1n9s (more details), 3.5 Å

PDB Description: crystal structure of yeast smf in spacegroup p43212

SCOP Domain Sequences for d1n9si_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9si_ b.38.1.1 (I:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae)}
pflkglvnhrvgvklkfnsteyrgtlvstdnyfnlqlneaeefvagvshgtlgeifirsn
nvlyirelpn

SCOP Domain Coordinates for d1n9si_:

Click to download the PDB-style file with coordinates for d1n9si_.
(The format of our PDB-style files is described here.)

Timeline for d1n9si_: