![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
![]() | Protein Small nuclear ribonucleoprotein F, Smf [82087] (2 species) 3jb9 chains I and n are F subunits from fission yeast; not included because sids are not case sensitive |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82088] (2 PDB entries) |
![]() | Domain d1n9sb_: 1n9s B: [80352] |
PDB Entry: 1n9s (more details), 3.5 Å
SCOPe Domain Sequences for d1n9sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n9sb_ b.38.1.1 (B:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lkglvnhrvgvklkfnsteyrgtlvstdnyfnlqlneaeefvagvshgtlgeifirsnnv lyirelpn
Timeline for d1n9sb_: