Class b: All beta proteins [48724] (177 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
Protein Small nuclear ribonucleoprotein F, Smf [82087] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82088] (2 PDB entries) |
Domain d1n9sa_: 1n9s A: [80351] |
PDB Entry: 1n9s (more details), 3.5 Å
SCOPe Domain Sequences for d1n9sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n9sa_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lkglvnhrvgvklkfnsteyrgtlvstdnyfnlqlneaeefvagvshgtlgeifirsnnv lyirelpn
Timeline for d1n9sa_: