Lineage for d1n9sa_ (1n9s A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2786772Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2787066Protein Small nuclear ribonucleoprotein F, Smf [82087] (2 species)
    3jb9 chains I and n are F subunits from fission yeast; not included because sids are not case sensitive
  7. 2787067Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82088] (2 PDB entries)
  8. 2787075Domain d1n9sa_: 1n9s A: [80351]
    missing some secondary structures that made up less than one-third of the common domain

Details for d1n9sa_

PDB Entry: 1n9s (more details), 3.5 Å

PDB Description: crystal structure of yeast smf in spacegroup p43212
PDB Compounds: (A:) Small nuclear ribonucleoprotein F

SCOPe Domain Sequences for d1n9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9sa_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lkglvnhrvgvklkfnsteyrgtlvstdnyfnlqlneaeefvagvshgtlgeifirsnnv
lyirelpn

SCOPe Domain Coordinates for d1n9sa_:

Click to download the PDB-style file with coordinates for d1n9sa_.
(The format of our PDB-style files is described here.)

Timeline for d1n9sa_: