Lineage for d1n9rg_ (1n9r G:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948630Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 948631Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 948632Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 948854Protein Small nuclear ribonucleoprotein F, Smf [82087] (1 species)
  7. 948855Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82088] (2 PDB entries)
  8. 948862Domain d1n9rg_: 1n9r G: [80350]

Details for d1n9rg_

PDB Entry: 1n9r (more details), 2.8 Å

PDB Description: Crystal structure of a heptameric ring complex of yeast SmF in spacegroup P4122
PDB Compounds: (G:) Small nuclear ribonucleoprotein F

SCOPe Domain Sequences for d1n9rg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9rg_ b.38.1.1 (G:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lkglvnhrvgvklkfnsteyrgtlvstdnyfnlqlneaeefvagvshgtlgeifircnnv
lyirelpn

SCOPe Domain Coordinates for d1n9rg_:

Click to download the PDB-style file with coordinates for d1n9rg_.
(The format of our PDB-style files is described here.)

Timeline for d1n9rg_: