Lineage for d1n9rf_ (1n9r F:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228326Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 228327Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 228328Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (6 proteins)
    forms homo and heteroheptameric ring structures
  6. 228477Protein Small nuclear ribonucleoprotein F, Smf [82087] (1 species)
  7. 228478Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82088] (2 PDB entries)
  8. 228484Domain d1n9rf_: 1n9r F: [80349]

Details for d1n9rf_

PDB Entry: 1n9r (more details), 2.8 Å

PDB Description: Crystal structure of a heptameric ring complex of yeast SmF in spacegroup P4122

SCOP Domain Sequences for d1n9rf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9rf_ b.38.1.1 (F:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae)}
flkglvnhrvgvklkfnsteyrgtlvstdnyfnlqlneaeefvagvshgtlgeifircnn
vlyirelpn

SCOP Domain Coordinates for d1n9rf_:

Click to download the PDB-style file with coordinates for d1n9rf_.
(The format of our PDB-style files is described here.)

Timeline for d1n9rf_: