![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins) |
![]() | Protein G protein-gated inward rectifier Girk1 [81967] (1 species) forms tetrameric cytoplasmic pore; contains a C-terminal extension |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [81968] (1 PDB entry) |
![]() | Domain d1n9pa_: 1n9p A: [80343] |
PDB Entry: 1n9p (more details), 1.8 Å
SCOPe Domain Sequences for d1n9pa_:
Sequence, based on SEQRES records: (download)
>d1n9pa_ b.1.18.16 (A:) G protein-gated inward rectifier Girk1 {Mouse (Mus musculus) [TaxId: 10090]} rqrfvdkngrcnvqhgnlgseraetlmfsehavismrdgkltlmfrvgnlrnshmvsaqi rckllksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydlsqrsm qteqfevvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysqfhat fevptppysvkeqeemllmssp
>d1n9pa_ b.1.18.16 (A:) G protein-gated inward rectifier Girk1 {Mouse (Mus musculus) [TaxId: 10090]} rqrfvdkngrcnvqheraetlmfsehavismrdgkltlmfrvgnlrnshmvsaqirckll ksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydlsqrsmqteqf evvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysqfhatfevpt ppysvkeqeemllmssp
Timeline for d1n9pa_: