Lineage for d1n9ja_ (1n9j A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2180922Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2180959Family d.17.1.2: Cystatins [54407] (7 proteins)
    automatically mapped to Pfam PF00031
  6. 2180965Protein Cystatin A (stefin A) [54412] (1 species)
  7. 2180966Species Human (Homo sapiens) [TaxId:9606] [54413] (12 PDB entries)
  8. 2180982Domain d1n9ja_: 1n9j A: [80341]
    segment-swapped dimer

Details for d1n9ja_

PDB Entry: 1n9j (more details)

PDB Description: solution structure of the 3d domain swapped dimer of stefin a
PDB Compounds: (A:) cystatin a

SCOPe Domain Sequences for d1n9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9ja_ d.17.1.2 (A:) Cystatin A (stefin A) {Human (Homo sapiens) [TaxId: 9606]}
mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf

SCOPe Domain Coordinates for d1n9ja_:

Click to download the PDB-style file with coordinates for d1n9ja_.
(The format of our PDB-style files is described here.)

Timeline for d1n9ja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1n9jb_