SCOP 1.73: Domain d1n9ab_: 1n9a B:

Lineage for d1n9ab_ (1n9a B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (27 PDB entries)

8. Domain d1n9ab_: 1n9a B: [80339]
   Other proteins in same PDB: d1n9aa_
   complexed with fti, hfp, zn

Details for d1n9ab_

PDB Entry: 1n9a, 3.2 Å

PDB Description: Farnesyltransferase complex with tetrahydropyridine inhibitors

PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOP Domain Sequences for d1n9ab_:

Sequence; same for both SEQRES and ATOM records:

>d1n9ab_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl
krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg
gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

Timeline for d1n9ab_:

• d1n9ab_ first appeared in SCOP 1.63
  
• d1n9ab_ appears in SCOP 1.71
  
• d1n9ab_ appears in SCOP 1.75
  
• d1n9ab_ appears in the current release, SCOPe 2.08