Lineage for d1n97b_ (1n97 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005005Protein Cyp175a1 [81869] (1 species)
    thermostable P450
  7. 2005006Species Thermus thermophilus [TaxId:274] [81870] (2 PDB entries)
    Uniprot Q53W59
  8. 2005008Domain d1n97b_: 1n97 B: [80336]
    complexed with edo, hem, srt

Details for d1n97b_

PDB Entry: 1n97 (more details), 1.8 Å

PDB Description: crystal structure of cyp175a1 from thermus thermophillus strain hb27
PDB Compounds: (B:) cyp175a1

SCOPe Domain Sequences for d1n97b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n97b_ a.104.1.1 (B:) Cyp175a1 {Thermus thermophilus [TaxId: 274]}
mkrlslreawpylkdlqqdplavllawgrahprlflplprfplalifdpegvegallaeg
ttkatfqyralsrltgrglltdwgeswkearkalkdpflpknvrgyreameeearaffge
wrgeerdldhemlalslrllgralfgkplspslaehalkaldrimaqtrsplalldlaae
arfrkdrgalyreaealivhpplshlpreralseavtllvaghetvasaltwsflllshr
pdwqkrvaeseeaalaafqealrlyppawiltrrlerplllgedrlppgttlvlspyvtq
rlhfpdgeafrperfleergtpsgryfpfglgqrlclgrdfallegpivlraffrrfrld
plpfprvlaqvtlrpegglparpre

SCOPe Domain Coordinates for d1n97b_:

Click to download the PDB-style file with coordinates for d1n97b_.
(The format of our PDB-style files is described here.)

Timeline for d1n97b_: