Lineage for d1n95b_ (1n95 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 920404Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 920721Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 920846Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 920847Protein Protein farnesyltransferase, beta-subunit [48247] (3 species)
  7. 920895Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (29 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 920945Domain d1n95b_: 1n95 B: [80334]
    Other proteins in same PDB: d1n95a_
    complexed with fth, hfp, zn

Details for d1n95b_

PDB Entry: 1n95 (more details), 2.3 Å

PDB Description: Aryl Tetrahydrophyridine Inhbitors of Farnesyltranferase: Glycine, Phenylalanine and Histidine Derivatives
PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOPe Domain Sequences for d1n95b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n95b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl
krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg
gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

SCOPe Domain Coordinates for d1n95b_:

Click to download the PDB-style file with coordinates for d1n95b_.
(The format of our PDB-style files is described here.)

Timeline for d1n95b_: