SCOP 1.71: Domain d1n94b_: 1n94 B:

Lineage for d1n94b_ (1n94 B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (26 PDB entries)

8. Domain d1n94b_: 1n94 B: [80332]
   Other proteins in same PDB: d1n94a_
   complexed with hfp, tin, zn

Details for d1n94b_

PDB Entry: 1n94, 3.5 Å

PDB Description: aryl tetrahydropyridine inhbitors of farnesyltransferase: glycine, phenylalanine and histidine derivates

SCOP Domain Sequences for d1n94b_:

Sequence; same for both SEQRES and ATOM records:

>d1n94b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus)}
plyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhy
lkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfg
ggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdv
rsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvi
lkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdp
alsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgam
lhdvvmgvpenvlqpthpvynigpdkviqatthflqk

Timeline for d1n94b_:

• d1n94b_ first appeared in SCOP 1.63
  
• d1n94b_ appears in SCOP 1.69
  
• d1n94b_ appears in SCOP 1.73
  
• d1n94b_ appears in the current release, SCOPe 2.08