Lineage for d1n8zc3 (1n8z C:166-322)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747642Superfamily g.3.9: Growth factor receptor domain [57184] (1 family) (S)
  5. 747643Family g.3.9.1: Growth factor receptor domain [57185] (5 proteins)
  6. 747662Protein Protooncoprotein Her2 extracellular domain [82889] (2 species)
  7. 747663Species Human (Homo sapiens) [TaxId:9606] [82890] (2 PDB entries)
  8. 747664Domain d1n8zc3: 1n8z C:166-322 [80324]
    Other proteins in same PDB: d1n8za1, d1n8za2, d1n8zb1, d1n8zb2, d1n8zc1, d1n8zc2

Details for d1n8zc3

PDB Entry: 1n8z (more details), 2.52 Å

PDB Description: Crystal structure of extracellular domain of human HER2 complexed with Herceptin Fab
PDB Compounds: (C:) Receptor protein-tyrosine kinase erbB-2

SCOP Domain Sequences for d1n8zc3:

Sequence, based on SEQRES records: (download)

>d1n8zc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp
khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd
vgsctlvcplhnqevtaedgtqrcekcskpcarvcyg

Sequence, based on observed residues (ATOM records): (download)

>d1n8zc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
rsrachpcspmckgsrcwgessedcqsltrtvcaggcarckgplptdccheqcaagctgp
khsdclaclhfnhsgicelhcpalvtyntdtfesmpnpegrytfgascvtacpynylstd
vgsctlvcplhnqevtatqrcekcskpcarvcyg

SCOP Domain Coordinates for d1n8zc3:

Click to download the PDB-style file with coordinates for d1n8zc3.
(The format of our PDB-style files is described here.)

Timeline for d1n8zc3: