Lineage for d1n8zc1 (1n8z C:1-165)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310356Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N
  4. 310397Superfamily c.10.2: L domain-like [52058] (8 families) (S)
    less regular structure consisting of variable repeats
  5. 310441Family c.10.2.5: L domain [52071] (4 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 310450Protein Protooncoprotein Her2 extracellular domain [82328] (2 species)
  7. 310451Species Human (Homo sapiens) [TaxId:9606] [82329] (1 PDB entry)
  8. 310452Domain d1n8zc1: 1n8z C:1-165 [80322]
    Other proteins in same PDB: d1n8za1, d1n8za2, d1n8zb1, d1n8zb2, d1n8zc3, d1n8zc4

Details for d1n8zc1

PDB Entry: 1n8z (more details), 2.52 Å

PDB Description: crystal structure of extracellular domain of human her2 complexed with herceptin fab

SCOP Domain Sequences for d1n8zc1:

Sequence, based on SEQRES records: (download)

>d1n8zc1 c.10.2.5 (C:1-165) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens)}
tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqg
yvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelql
rslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtn

Sequence, based on observed residues (ATOM records): (download)

>d1n8zc1 c.10.2.5 (C:1-165) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens)}
tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevqg
yvliahnqvrqvplqrlrivrgtqlfednyalavldngdplspgglrelqlrslteilkg
gvliqrnpqlcyqdtilwkdifhknnqlaltlidtn

SCOP Domain Coordinates for d1n8zc1:

Click to download the PDB-style file with coordinates for d1n8zc1.
(The format of our PDB-style files is described here.)

Timeline for d1n8zc1: