Lineage for d1n8zb2 (1n8z B:121-220)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365023Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 365087Domain d1n8zb2: 1n8z B:121-220 [80321]
    Other proteins in same PDB: d1n8za1, d1n8za2, d1n8zb1, d1n8zc1, d1n8zc2, d1n8zc3, d1n8zc4
    part of humanized Fab 4D5, herceptin
    complexed with nag, so4

Details for d1n8zb2

PDB Entry: 1n8z (more details), 2.52 Å

PDB Description: crystal structure of extracellular domain of human her2 complexed with herceptin fab

SCOP Domain Sequences for d1n8zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8zb2 b.1.1.2 (B:121-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOP Domain Coordinates for d1n8zb2:

Click to download the PDB-style file with coordinates for d1n8zb2.
(The format of our PDB-style files is described here.)

Timeline for d1n8zb2: