SCOP 1.63: Domain d1n8zb2: 1n8z B:121-220

Lineage for d1n8zb2 (1n8z B:121-220)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Herceptin Fab 4D5 (synthetic, humanised version), kappa L chain [48992] (3 PDB entries)

8. Domain d1n8zb2: 1n8z B:121-220 [80321]
   Other proteins in same PDB: d1n8za1, d1n8zb1, d1n8zc1, d1n8zc2, d1n8zc3, d1n8zc4
   complexed with nag, so4

Details for d1n8zb2

PDB Entry: 1n8z, 2.52 Å

PDB Description: crystal structure of extracellular domain of human her2 complexed with herceptin fab

SCOP Domain Sequences for d1n8zb2:

Sequence; same for both SEQRES and ATOM records:

>d1n8zb2 b.1.1.2 (B:121-220) Immunoglobulin (constant domains of L and H chains) {Herceptin Fab 4D5 (synthetic, humanised version), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d1n8zb2:

• d1n8zb2 is new in SCOP 1.63
  
• d1n8zb2 appears in SCOP 1.65
  
• d1n8zb2 appears in the current release, SCOPe 2.08