| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
| Species Herceptin Fab 4D5 (synthetic, humanised version), kappa L chain [48992] (3 PDB entries) |
| Domain d1n8zb2: 1n8z B:121-220 [80321] Other proteins in same PDB: d1n8za1, d1n8zb1, d1n8zc1, d1n8zc2, d1n8zc3, d1n8zc4 complexed with nag, so4 |
PDB Entry: 1n8z (more details), 2.52 Å
SCOP Domain Sequences for d1n8zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n8zb2 b.1.1.2 (B:121-220) Immunoglobulin (constant domains of L and H chains) {Herceptin Fab 4D5 (synthetic, humanised version), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
Timeline for d1n8zb2: