SCOP 1.67: Domain d1n8yc1: 1n8y C:1-165

Lineage for d1n8yc1 (1n8y C:1-165)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (8 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.5: L domain [52071] (4 proteins)
   this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain

6. Protein Protooncoprotein Her2 extracellular domain [82328] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [82330] (1 PDB entry)

8. Domain d1n8yc1: 1n8y C:1-165 [80314]
   Other proteins in same PDB: d1n8yc3, d1n8yc4

Details for d1n8yc1

PDB Entry: 1n8y, 2.4 Å

PDB Description: crystal structure of the extracellular region of rat her2

SCOP Domain Sequences for d1n8yc1:

Sequence, based on SEQRES records:

>d1n8yc1 c.10.2.5 (C:1-165) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus)}
tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltyvpanaslsflqdiqevqg
ymliahnqvkrvplqrlrivrgtqlfedkyalavldnrdpqdnvaastpgrtpeglrelq
lrslteilkggvlirgnpqlcyqdmvlwkdvfrknnqlapvdidt

Sequence, based on observed residues (ATOM records):

>d1n8yc1 c.10.2.5 (C:1-165) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus)}
tqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltyvpanaslsflqdiqevqg
ymliahnqvkrvplqrlrivrgtqlfedkyalavldnrdpqpeglrelqlrslteilkgg
vlirgnpqlcyqdmvlwkdvfrknnqlapvdidt

Timeline for d1n8yc1:

• d1n8yc1 first appeared in SCOP 1.63
  
• d1n8yc1 appears in SCOP 1.65
  
• d1n8yc1 appears in SCOP 1.69
  
• d1n8yc1 appears in the current release, SCOPe 2.08