Lineage for d1n8wb_ (1n8w B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088435Superfamily c.1.13: Malate synthase G [51645] (1 family) (S)
  5. 2088436Family c.1.13.1: Malate synthase G [51646] (2 protein domains)
  6. 2088437Protein Malate synthase G [51647] (3 species)
    contains the insert of all-beta (sub)domain and the C-terminal extension of all-alpha (sub)domain
  7. 2088444Species Mycobacterium tuberculosis [TaxId:1773] [82274] (3 PDB entries)
  8. 2088449Domain d1n8wb_: 1n8w B: [80313]
    complexed with coa, glv, mg, mlt, so4

Details for d1n8wb_

PDB Entry: 1n8w (more details), 2.7 Å

PDB Description: Biochemical and Structural Studies of Malate Synthase from Mycobacterium tuberculosis
PDB Compounds: (B:) Probable malate synthase G

SCOPe Domain Sequences for d1n8wb_:

Sequence, based on SEQRES records: (download)

>d1n8wb_ c.1.13.1 (B:) Malate synthase G {Mycobacterium tuberculosis [TaxId: 1773]}
drvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelqa
qidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpvl
narfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvpl
ssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhieil
idpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaaa
vdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegi
mdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlgl
pqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgt
mksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawv
psptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnnc
qsilgyvvrwvdqgvgcskvpdihdvalmedratlrissqllanwlrhgvitsadvrasl
ermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefk
araae

Sequence, based on observed residues (ATOM records): (download)

>d1n8wb_ c.1.13.1 (B:) Malate synthase G {Mycobacterium tuberculosis [TaxId: 1773]}
drvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelqa
qidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpvl
narfalnaanarwgslydalygtdvipetkgptynkvrgdkviayarkflddsvplssgs
fgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhieilidpe
sqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaaavflr
vlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegimdalftglia
ihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpqntmkigim
deerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmksqpwilay
edhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpsptaatlha
lhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnncqsilgyvvrw
vdqgvgcskvpdihdvalmedratlrissqllanwlrhgvitsadvraslermaplvdrq
nagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefkaraae

SCOPe Domain Coordinates for d1n8wb_:

Click to download the PDB-style file with coordinates for d1n8wb_.
(The format of our PDB-style files is described here.)

Timeline for d1n8wb_: