Lineage for d1n8sc2 (1n8s C:545-590)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582576Superfamily g.3.10: Colipase-like [57190] (2 families) (S)
  5. 2582577Family g.3.10.1: Colipase-like [57191] (2 protein domains)
  6. 2582578Protein (Pro)colipase [57192] (1 species)
    duplication: consists of two (sub)domains of this common fold
  7. 2582579Species Pig (Sus scrofa) [TaxId:9823] [57193] (6 PDB entries)
  8. 2582589Domain d1n8sc2: 1n8s C:545-590 [80311]
    Other proteins in same PDB: d1n8sa1, d1n8sa2

Details for d1n8sc2

PDB Entry: 1n8s (more details), 3.04 Å

PDB Description: structure of the pancreatic lipase-colipase complex
PDB Compounds: (C:) colipase II

SCOPe Domain Sequences for d1n8sc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8sc2 g.3.10.1 (C:545-590) (Pro)colipase {Pig (Sus scrofa) [TaxId: 9823]}
ensecsaftlygvyykcpcergltcegdkslvgsitntnfgichnv

SCOPe Domain Coordinates for d1n8sc2:

Click to download the PDB-style file with coordinates for d1n8sc2.
(The format of our PDB-style files is described here.)

Timeline for d1n8sc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n8sc1