Lineage for d1n8sa2 (1n8s A:1-336)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 248565Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 248566Superfamily c.69.1: alpha/beta-Hydrolases [53474] (26 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 248961Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (1 protein)
  6. 248962Protein Pancreatic lipase, N-terminal domain [53578] (6 species)
    contains additional, colipase-binding domain
  7. 248970Species Human (Homo sapiens) [TaxId:9606] [53581] (3 PDB entries)
  8. 248973Domain d1n8sa2: 1n8s A:1-336 [80309]
    Other proteins in same PDB: d1n8sa1, d1n8sc1, d1n8sc2

Details for d1n8sa2

PDB Entry: 1n8s (more details), 3.04 Å

PDB Description: structure of the pancreatic lipase-colipase complex

SCOP Domain Sequences for d1n8sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8sa2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Human (Homo sapiens)}
kevcyerlgcfsddspwsgiterplhilpwspkdvntrfllytnenpnnfqevaadsssi
sgsnfktnrktrfiihgfidkgeenwlanvcknlfkvesvncicvdwkggsrtgytqasq
nirivgaevayfveflqsafgyspsnvhvighslgahaageagrrtngtigritgldpae
pcfqgtpelvrldpsdakfvdvihtdgapivpnlgfgmsqvvghldffpnggvempgckk
nilsqivdidgiwegtrdfaacnhlrsykyytdsivnpdgfagfpcasynvftankcfpc
psggcpqmghyadrypgktndvgqkfyldtgdasnfa

SCOP Domain Coordinates for d1n8sa2:

Click to download the PDB-style file with coordinates for d1n8sa2.
(The format of our PDB-style files is described here.)

Timeline for d1n8sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n8sa1