SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1n8sa1 (1n8s A:337-449)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038801Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2038802Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2038839Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
    automatically mapped to Pfam PF01477
  6. 2038840Protein Pancreatic lipase, C-terminal domain [49731] (6 species)
  7. 2038848Species Human (Homo sapiens) [TaxId:9606] [49734] (3 PDB entries)
  8. 2038851Domain d1n8sa1: 1n8s A:337-449 [80308]
    Other proteins in same PDB: d1n8sa2, d1n8sc1, d1n8sc2

Details for d1n8sa1

PDB Entry: 1n8s (more details), 3.04 Å

PDB Description: Structure of the pancreatic lipase-colipase complex
PDB Compounds: (A:) Triacylglycerol lipase, pancreatic

SCOPe Domain Sequences for d1n8sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8sa1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rwrykvsvtlsgkkvtghilvslfgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlq
mvkfiwynnvinptlprvgaskiivetnvgkqfnfcspetvreevlltltpc

SCOPe Domain Coordinates for d1n8sa1:

Click to download the PDB-style file with coordinates for d1n8sa1.
(The format of our PDB-style files is described here.)

Timeline for d1n8sa1:

2038851
d1n8sa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1n8sa2