Lineage for d1n8pc_ (1n8p C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2503335Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2503413Protein Cystathionine gamma-lyase (CYS3) [82484] (1 species)
  7. 2503414Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82485] (1 PDB entry)
  8. 2503417Domain d1n8pc_: 1n8p C: [80306]
    complexed with plp

Details for d1n8pc_

PDB Entry: 1n8p (more details), 2.6 Å

PDB Description: Crystal Structure of cystathionine gamma-lyase from yeast
PDB Compounds: (C:) Cystathionine gamma-lyase

SCOPe Domain Sequences for d1n8pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8pc_ c.67.1.3 (C:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlqesdkfatkaihagehvdvhgsviepislsttfkqsspanpigtyeysrsqnpnrenl
eravaalenaqyglafssgsattatilqslpqgshavsigdvyggthryftkvanahgve
tsftndllndlpqlikentklvwietptnptlkvtdiqkvadlikkhaagqdvilvvdnt
flspyisnplnfgadivvhsatkyinghsdvvlgvlatnnkplyerlqflqnaigaipsp
fdawlthrglktlhlrvrqaalsankiaeflaadkenvvavnypglkthpnydvvlkqhr
dalgggmisfrikggaeaaskfasstrlftlaeslggiesllevpavmthggipkearea
sgvfddlvrisvgiedtddlledikqalkqatn

SCOPe Domain Coordinates for d1n8pc_:

Click to download the PDB-style file with coordinates for d1n8pc_.
(The format of our PDB-style files is described here.)

Timeline for d1n8pc_: