![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
![]() | Protein Cystathionine gamma-lyase (CYS3) [82484] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82485] (1 PDB entry) |
![]() | Domain d1n8pb_: 1n8p B: [80305] complexed with plp |
PDB Entry: 1n8p (more details), 2.6 Å
SCOPe Domain Sequences for d1n8pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n8pb_ c.67.1.3 (B:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tlqesdkfatkaihagehvdvhgsviepislsttfkqsspanpigtyeysrsqnpnrenl eravaalenaqyglafssgsattatilqslpqgshavsigdvyggthryftkvanahgve tsftndllndlpqlikentklvwietptnptlkvtdiqkvadlikkhaagqdvilvvdnt flspyisnplnfgadivvhsatkyinghsdvvlgvlatnnkplyerlqflqnaigaipsp fdawlthrglktlhlrvrqaalsankiaeflaadkenvvavnypglkthpnydvvlkqhr dalgggmisfrikggaeaaskfasstrlftlaeslggiesllevpavmthggipkearea sgvfddlvrisvgiedtddlledikqalkqatn
Timeline for d1n8pb_: