Lineage for d1n8pa_ (1n8p A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247822Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 247823Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 248050Family c.67.1.3: Cystathionine synthase-like [53402] (9 proteins)
  6. 248086Protein Cystathionine gamma-lyase (CYS3) [82484] (1 species)
  7. 248087Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82485] (1 PDB entry)
  8. 248088Domain d1n8pa_: 1n8p A: [80304]

Details for d1n8pa_

PDB Entry: 1n8p (more details), 2.6 Å

PDB Description: Crystal Structure of cystathionine gamma-lyase from yeast

SCOP Domain Sequences for d1n8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae)}
tlqesdkfatkaihagehvdvhgsviepislsttfkqsspanpigtyeysrsqnpnrenl
eravaalenaqyglafssgsattatilqslpqgshavsigdvyggthryftkvanahgve
tsftndllndlpqlikentklvwietptnptlkvtdiqkvadlikkhaagqdvilvvdnt
flspyisnplnfgadivvhsatkyinghsdvvlgvlatnnkplyerlqflqnaigaipsp
fdawlthrglktlhlrvrqaalsankiaeflaadkenvvavnypglkthpnydvvlkqhr
dalgggmisfrikggaeaaskfasstrlftlaeslggiesllevpavmthggipkearea
sgvfddlvrisvgiedtddlledikqalkqatn

SCOP Domain Coordinates for d1n8pa_:

Click to download the PDB-style file with coordinates for d1n8pa_.
(The format of our PDB-style files is described here.)

Timeline for d1n8pa_: