![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
![]() | Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) ![]() |
![]() | Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein) |
![]() | Protein Ecotin, trypsin inhibitor [49774] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49775] (13 PDB entries) |
![]() | Domain d1n8oe_: 1n8o E: [80303] Other proteins in same PDB: d1n8o.1 |
PDB Entry: 1n8o (more details), 2 Å
SCOP Domain Sequences for d1n8oe_:
Sequence, based on SEQRES records: (download)
>d1n8oe_ b.16.1.1 (E:) Ecotin, trypsin inhibitor {Escherichia coli} qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl egwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvd vkyrvwkaeekidnavvr
>d1n8oe_ b.16.1.1 (E:) Ecotin, trypsin inhibitor {Escherichia coli} qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl egwgydyyvfdkvsspvstmmacpdkekkfvtaylgdagmlrynsklpivvytpdnvdvk yrvwkaeekidnavvr
Timeline for d1n8oe_: