SCOP 1.63: Domain d1n8oe_: 1n8o E:

Lineage for d1n8oe_ (1n8o E:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (13 PDB entries)

8. Domain d1n8oe_: 1n8o E: [80303]
   Other proteins in same PDB: d1n8o.1

Details for d1n8oe_

PDB Entry: 1n8o, 2 Å

PDB Description: crystal structure of a complex between bovine chymotrypsin and ecotin

SCOP Domain Sequences for d1n8oe_:

Sequence, based on SEQRES records:

>d1n8oe_ b.16.1.1 (E:) Ecotin, trypsin inhibitor {Escherichia coli}
qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
egwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvd
vkyrvwkaeekidnavvr

Sequence, based on observed residues (ATOM records):

>d1n8oe_ b.16.1.1 (E:) Ecotin, trypsin inhibitor {Escherichia coli}
qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
egwgydyyvfdkvsspvstmmacpdkekkfvtaylgdagmlrynsklpivvytpdnvdvk
yrvwkaeekidnavvr

Timeline for d1n8oe_:

• d1n8oe_ is new in SCOP 1.63
  
• d1n8oe_ appears in SCOP 1.65
  
• d1n8oe_ appears in the current release, SCOPe 2.08