Lineage for d1n8oe_ (1n8o E:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 225879Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology with the crossing loops
  4. 225880Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
  5. 225881Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)
  6. 225882Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 225883Species Escherichia coli [TaxId:562] [49775] (13 PDB entries)
  8. 225886Domain d1n8oe_: 1n8o E: [80303]
    Other proteins in same PDB: d1n8o.1

Details for d1n8oe_

PDB Entry: 1n8o (more details), 2 Å

PDB Description: crystal structure of a complex between bovine chymotrypsin and ecotin

SCOP Domain Sequences for d1n8oe_:

Sequence, based on SEQRES records: (download)

>d1n8oe_ b.16.1.1 (E:) Ecotin, trypsin inhibitor {Escherichia coli}
qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
egwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvd
vkyrvwkaeekidnavvr

Sequence, based on observed residues (ATOM records): (download)

>d1n8oe_ b.16.1.1 (E:) Ecotin, trypsin inhibitor {Escherichia coli}
qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
egwgydyyvfdkvsspvstmmacpdkekkfvtaylgdagmlrynsklpivvytpdnvdvk
yrvwkaeekidnavvr

SCOP Domain Coordinates for d1n8oe_:

Click to download the PDB-style file with coordinates for d1n8oe_.
(The format of our PDB-style files is described here.)

Timeline for d1n8oe_: