SCOP 1.67: Domain d1n8o.1: 1n8o A:,B:,C:

Lineage for d1n8o.1 (1n8o A:,B:,C:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (50 PDB entries)

8. Domain d1n8o.1: 1n8o A:,B:,C: [80302]
   Other proteins in same PDB: d1n8oe_

Details for d1n8o.1

PDB Entry: 1n8o, 2 Å

PDB Description: crystal structure of a complex between bovine chymotrypsin and ecotin

SCOP Domain Sequences for d1n8o.1:

Sequence; same for both SEQRES and ATOM records:

>g1n8o.1 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
psasddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicag
asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
n

Timeline for d1n8o.1:

• d1n8o.1 first appeared in SCOP 1.63
  
• d1n8o.1 appears in SCOP 1.65
  
• d1n8o.1 appears in SCOP 1.69
  
• d1n8o.1 appears in the current release, SCOPe 2.08