Lineage for d1n8ed_ (1n8e D:)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431024Fold h.1: Parallel coiled-coil [57943] (27 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 431436Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 431437Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 431438Protein Fibrinogen alpha chain [88887] (4 species)
  7. 431447Species Human (Homo sapiens) [TaxId:9606] [88889] (13 PDB entries)
  8. 431473Domain d1n8ed_: 1n8e D: [80292]
    Other proteins in same PDB: d1n8eb1, d1n8eb2, d1n8ec1, d1n8ec2, d1n8ee1, d1n8ee2, d1n8ef1, d1n8ef2
    coiled-coil region only

Details for d1n8ed_

PDB Entry: 1n8e (more details), 4.5 Å

PDB Description: Fragment Double-D from Human Fibrin

SCOP Domain Sequences for d1n8ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8ed_ h.1.8.1 (D:) Fibrinogen alpha chain {Human (Homo sapiens)}
ievlkrkviekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdy
edqqkqleqviakd

SCOP Domain Coordinates for d1n8ed_:

Click to download the PDB-style file with coordinates for d1n8ed_.
(The format of our PDB-style files is described here.)

Timeline for d1n8ed_: