Lineage for d1n8ec2 (1n8e C:97-141)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1968888Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 1968889Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 1969001Protein Fibrinogen gamma chain [88898] (4 species)
  7. 1969010Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
    Uniprot P02679
  8. 1969042Domain d1n8ec2: 1n8e C:97-141 [80291]
    Other proteins in same PDB: d1n8ea_, d1n8eb1, d1n8eb2, d1n8ec1, d1n8ed_, d1n8ee1, d1n8ee2, d1n8ef1
    coiled-coil region only

Details for d1n8ec2

PDB Entry: 1n8e (more details), 4.5 Å

PDB Description: Fragment Double-D from Human Fibrin
PDB Compounds: (C:) Fibrin gamma chain

SCOPe Domain Sequences for d1n8ec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8ec2 h.1.8.1 (C:97-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
easilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckd

SCOPe Domain Coordinates for d1n8ec2:

Click to download the PDB-style file with coordinates for d1n8ec2.
(The format of our PDB-style files is described here.)

Timeline for d1n8ec2: