Lineage for d1n7ta1 (1n7t A:5-103)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395523Protein Erbin [82085] (1 species)
  7. 2395524Species Human (Homo sapiens) [TaxId:9606] [82086] (4 PDB entries)
  8. 2395529Domain d1n7ta1: 1n7t A:5-103 [80275]
    Other proteins in same PDB: d1n7ta2
    complexed with a phage-derived peptide

Details for d1n7ta1

PDB Entry: 1n7t (more details)

PDB Description: erbin pdz domain bound to a phage-derived peptide
PDB Compounds: (A:) 99-mer peptide of densin-180-like protein

SCOPe Domain Sequences for d1n7ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7ta1 b.36.1.1 (A:5-103) Erbin {Human (Homo sapiens) [TaxId: 9606]}
ghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskllqpgd
kiiqangysfiniehgqavsllktfqntveliivrevss

SCOPe Domain Coordinates for d1n7ta1:

Click to download the PDB-style file with coordinates for d1n7ta1.
(The format of our PDB-style files is described here.)

Timeline for d1n7ta1: