Lineage for d1n7sb_ (1n7s B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1969135Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 1969136Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 1969192Protein Syntaxin 1A [88908] (3 species)
  7. 1969199Species Norway rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries)
    Uniprot P32851 196-259
    a globular structure of a larger fragment containing this region is available; seepdb:1dn1, chain B
  8. 1969200Domain d1n7sb_: 1n7s B: [80272]
    Other proteins in same PDB: d1n7sa_, d1n7sc_, d1n7sd_
    complex with synaptobrevin and SNAP-25 fragments
    complexed with ca, mpd

Details for d1n7sb_

PDB Entry: 1n7s (more details), 1.45 Å

PDB Description: high resolution structure of a truncated neuronal snare complex
PDB Compounds: (B:) syntaxin 1a

SCOPe Domain Sequences for d1n7sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7sb_ h.1.15.1 (B:) Syntaxin 1A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyverav
sdtkkavk

SCOPe Domain Coordinates for d1n7sb_:

Click to download the PDB-style file with coordinates for d1n7sb_.
(The format of our PDB-style files is described here.)

Timeline for d1n7sb_: