| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (2 families) ![]() tetrameric parallel coiled coil |
| Family h.1.15.1: SNARE fusion complex [58039] (12 proteins) |
| Protein Syntaxin 1A [88908] (3 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries) Uniprot P32851 196-259 a globular structure of a larger fragment containing this region is available; seepdb:1dn1, chain B |
| Domain d1n7sb1: 1n7s B:191-256 [80272] Other proteins in same PDB: d1n7sa1, d1n7sa2, d1n7sb2, d1n7sc1, d1n7sc2, d1n7sd1, d1n7sd2 complex with synaptobrevin and SNAP-25 fragments complexed with ca, mpd |
PDB Entry: 1n7s (more details), 1.45 Å
SCOPe Domain Sequences for d1n7sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n7sb1 h.1.15.1 (B:191-256) Syntaxin 1A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsd
tkkavk
Timeline for d1n7sb1: