Lineage for d1n7qa1 (1n7q A:170-540)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216372Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 216472Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incoplete toroid
  5. 216478Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (2 proteins)
  6. 216486Protein Hyaluronate lyase [48237] (2 species)
  7. 216491Species Streptococcus pneumoniae [TaxId:1313] [48238] (10 PDB entries)
  8. 216501Domain d1n7qa1: 1n7q A:170-540 [80265]
    Other proteins in same PDB: d1n7qa2, d1n7qa3
    complexed with gcu, nag; mutant

Details for d1n7qa1

PDB Entry: 1n7q (more details), 2.3 Å

PDB Description: streptococcus pneumoniae hyaluronate lyase w291a/w292a double mutant complex with hyaluronan hexasacchride

SCOP Domain Sequences for d1n7qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7qa1 a.102.3.2 (A:170-540) Hyaluronate lyase {Streptococcus pneumoniae}
vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
naadyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggn
lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgayg
nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
lsdagvasvpr

SCOP Domain Coordinates for d1n7qa1:

Click to download the PDB-style file with coordinates for d1n7qa1.
(The format of our PDB-style files is described here.)

Timeline for d1n7qa1: