Lineage for d1n7pa1 (1n7p A:170-540)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004354Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 2004372Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (5 protein domains)
  6. 2004390Protein Hyaluronate lyase [48237] (2 species)
  7. 2004391Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [48238] (18 PDB entries)
    Uniprot Q54873 287-1007
  8. 2004395Domain d1n7pa1: 1n7p A:170-540 [80262]
    Other proteins in same PDB: d1n7pa2, d1n7pa3
    mutant

Details for d1n7pa1

PDB Entry: 1n7p (more details), 1.55 Å

PDB Description: streptococcus pneumoniae hyaluronate lyase w292a/f343v double mutant
PDB Compounds: (A:) hyaluronidase

SCOPe Domain Sequences for d1n7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7pa1 a.102.3.2 (A:170-540) Hyaluronate lyase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
nwadyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpvkalggn
lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgayg
nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
lsdagvasvpr

SCOPe Domain Coordinates for d1n7pa1:

Click to download the PDB-style file with coordinates for d1n7pa1.
(The format of our PDB-style files is described here.)

Timeline for d1n7pa1: