Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1n7ml2: 1n7m L:115-216 [80255] Other proteins in same PDB: d1n7mh1, d1n7mh2, d1n7ml1 part of metal chelatase catalytic Fab 7G12; germline antibody; chain identifiers are probably mixed up complexed with mmp |
PDB Entry: 1n7m (more details), 1.8 Å
SCOP Domain Sequences for d1n7ml2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n7ml2 b.1.1.2 (L:115-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
Timeline for d1n7ml2: