![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
![]() | Species Metal chelatase catalytic Fab 7G12, (human), kappa L chain [49089] (5 PDB entries) |
![]() | Domain d1n7ml2: 1n7m L:115-216 [80255] Other proteins in same PDB: d1n7mh1, d1n7ml1 germline antibody; chain identifiers are probably mixed up complexed with mmp |
PDB Entry: 1n7m (more details), 1.8 Å
SCOP Domain Sequences for d1n7ml2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n7ml2 b.1.1.2 (L:115-216) Immunoglobulin (constant domains of L and H chains) {Metal chelatase catalytic Fab 7G12, (human), kappa L chain} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
Timeline for d1n7ml2: