SCOP 1.67: Domain d1n7ml1: 1n7m L:1-114

Lineage for d1n7ml1 (1n7m L:1-114)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (141 PDB entries)

8. Domain d1n7ml1: 1n7m L:1-114 [80254]
   Other proteins in same PDB: d1n7mh1, d1n7mh2, d1n7ml2
   part of metal chelatase catalytic Fab 7G12; germline antibody; chain identifiers are probably mixed up
   complexed with mmp

Details for d1n7ml1

PDB Entry: 1n7m, 1.8 Å

PDB Description: Germline 7G12 with N-methylmesoporphyrin

SCOP Domain Sequences for d1n7ml1:

Sequence; same for both SEQRES and ATOM records:

>d1n7ml1 b.1.1.1 (L:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
nekfkskatltvdkpsstaymqlssltsedsavyyctrrdsdywgagttvtvss

Timeline for d1n7ml1:

• d1n7ml1 first appeared in SCOP 1.63
  
• d1n7ml1 appears in SCOP 1.65
  
• d1n7ml1 appears in SCOP 1.69
  
• d1n7ml1 appears in the current release, SCOPe 2.08