Lineage for d1n7mh2 (1n7m H:108-213)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549708Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549716Domain d1n7mh2: 1n7m H:108-213 [80253]
    Other proteins in same PDB: d1n7mh1, d1n7ml1, d1n7ml2
    part of metal chelatase catalytic Fab 7G12; germline antibody; chain identifiers are probably mixed up
    complexed with mmp

Details for d1n7mh2

PDB Entry: 1n7m (more details), 1.8 Å

PDB Description: Germline 7G12 with N-methylmesoporphyrin

SCOP Domain Sequences for d1n7mh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7mh2 b.1.1.2 (H:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOP Domain Coordinates for d1n7mh2:

Click to download the PDB-style file with coordinates for d1n7mh2.
(The format of our PDB-style files is described here.)

Timeline for d1n7mh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n7mh1