Lineage for d1n7hb_ (1n7h B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091402Protein GDP-mannose 4,6-dehydratase [51759] (4 species)
  7. 2091415Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [82289] (2 PDB entries)
  8. 2091417Domain d1n7hb_: 1n7h B: [80251]
    complexed with gdp, ndp

Details for d1n7hb_

PDB Entry: 1n7h (more details), 1.8 Å

PDB Description: Crystal Structure of GDP-mannose 4,6-dehydratase ternary complex with NADPH and GDP
PDB Compounds: (B:) GDP-D-mannose-4,6-dehydratase

SCOPe Domain Sequences for d1n7hb_:

Sequence, based on SEQRES records: (download)

>d1n7hb_ c.2.1.2 (B:) GDP-mannose 4,6-dehydratase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rkialitgitgqdgsyltefllgkgyevhglirrssnfntqrinhiyidphnvnkalmkl
hyadltdasslrrwidvikpdevynlaaqshvavsfeipdytadvvatgalrlleavrsh
tidsgrtvkyyqagssemfgstpppqsettpfhprspyaaskcaahwytvnyreayglfa
cngilfnhesprrgenfvtrkitralgrikvglqtklflgnlqasrdwgfagdyveamwl
mlqqekpddyvvateeghtveefldvsfgylglnwkdyveidqryfrpaevdnlqgdask
akevlgwkpqvgfeklvkmmvdedlelakrekvlvdagym

Sequence, based on observed residues (ATOM records): (download)

>d1n7hb_ c.2.1.2 (B:) GDP-mannose 4,6-dehydratase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rkialitgitgqdgsyltefllgkgyevhglirrssnfntqrinhiyikalmklhyadlt
dasslrrwidvikpdevynlaaqshvavsfeipdytadvvatgalrlleavrshtidsgr
tvkyyqagssemfgstpppqsettpfhprspyaaskcaahwytvnyreayglfacngilf
nhesprrgenfvtrkitralgrikvglqtklflgnlqasrdwgfagdyveamwlmlqqek
pddyvvateeghtveefldvsfgylglnwkdyveidqryfrpaevdnlqgdaskakevlg
wkpqvgfeklvkmmvdedlelakrekvlvdagym

SCOPe Domain Coordinates for d1n7hb_:

Click to download the PDB-style file with coordinates for d1n7hb_.
(The format of our PDB-style files is described here.)

Timeline for d1n7hb_: