Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein GDP-mannose 4,6-dehydratase [51759] (4 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [82289] (2 PDB entries) |
Domain d1n7gd_: 1n7g D: [80249] complexed with gdr, ndp has additional subdomain(s) that are not in the common domain |
PDB Entry: 1n7g (more details), 2.2 Å
SCOPe Domain Sequences for d1n7gd_:
Sequence, based on SEQRES records: (download)
>d1n7gd_ c.2.1.2 (D:) GDP-mannose 4,6-dehydratase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rkialitgitgqdgsyltefllgkgyevhglirrssnfntqrinhiyidphnvnkalmkl hyadltdasslrrwidvikpdevynlaaqshvavsfeipdytadvvatgalrlleavrsh tidsgrtvkyyqagssemfgstpppqsettpfhprspyaaskcaahwytvnyreayglfa cngilfnhesprrgenfvtrkitralgrikvglqtklflgnlqasrdwgfagdyveamwl mlqqekpddyvvateeghtveefldvsfgylglnwkdyveidqryfrpaevdnlqgdask akevlgwkpqvgfeklvkmmvdedlelakrekvlv
>d1n7gd_ c.2.1.2 (D:) GDP-mannose 4,6-dehydratase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rkialitgitgqdgsyltefllgkgyevhglirrssnfntqrinhiyilmklhyadltda sslrrwidvikpdevynlaaqshvavsfeipdytadvvatgalrlleavrshtidsgrtv kyyqagssemfgstpppqsettpfhprspyaaskcaahwytvnyreayglfacngilfnh esprrgenfvtrkitralgrikvglqtklfasrdwgfagdyveamwlmlqqekpddyvva teeghtveefldvsfgylglnwkdyveiddnlqgdaskakevlgwkpqvgfeklvkmmvd edlelakrekvlv
Timeline for d1n7gd_: