Lineage for d1n7daa (1n7d A:252-295)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 270146Fold g.12: LDL receptor-like module [57423] (1 superfamily)
  4. 270147Superfamily g.12.1: LDL receptor-like module [57424] (1 family) (S)
  5. 270148Family g.12.1.1: LDL receptor-like module [57425] (2 proteins)
  6. 270149Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 270150Species Human (Homo sapiens) [TaxId:9606] [57427] (10 PDB entries)
  8. 270166Domain d1n7daa: 1n7d A:252-295 [80245]
    Other proteins in same PDB: d1n7da1, d1n7da2, d1n7da3, d1n7da4
    all but the first modules in the whole receptor structure context
    complexed with ca, keg, man, nag; mutant

Details for d1n7daa

PDB Entry: 1n7d (more details), 3.7 Å

PDB Description: extracellular domain of the ldl receptor

SCOP Domain Sequences for d1n7daa:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7daa g.12.1.1 (A:252-295) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens)}
vtlcegpnkfkchsgecitldkvcnmardcrdwsdepikecgtn

SCOP Domain Coordinates for d1n7daa:

Click to download the PDB-style file with coordinates for d1n7daa.
(The format of our PDB-style files is described here.)

Timeline for d1n7daa: