Lineage for d1n7da9 (1n7d A:212-251)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1063689Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 1063690Superfamily g.12.1: LDL receptor-like module [57424] (1 family) (S)
  5. 1063691Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)
  6. 1063701Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 1063702Species Human (Homo sapiens) [TaxId:9606] [57427] (12 PDB entries)
    Uniprot P01130 272-353
  8. 1063720Domain d1n7da9: 1n7d A:212-251 [80244]
    Other proteins in same PDB: d1n7da1, d1n7da2, d1n7da3, d1n7da4
    all but the first modules in the whole receptor structure context
    complexed with ca, keg

Details for d1n7da9

PDB Entry: 1n7d (more details), 3.7 Å

PDB Description: extracellular domain of the ldl receptor
PDB Compounds: (A:) low-density lipoprotein receptor

SCOPe Domain Sequences for d1n7da9:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7da9 g.12.1.1 (A:212-251) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
vatcrpdefqcsdgncihgsrqcdreydckdmsdevgcvn

SCOPe Domain Coordinates for d1n7da9:

Click to download the PDB-style file with coordinates for d1n7da9.
(The format of our PDB-style files is described here.)

Timeline for d1n7da9: