Lineage for d1n7da9 (1n7d A:212-251)
- Root: SCOP 1.63
Class g: Small proteins [56992] (61 folds) 
Fold g.12: LDL receptor-like module [57423] (1 superfamily) Superfamily g.12.1: LDL receptor-like module [57424] (1 family) 
Family g.12.1.1: LDL receptor-like module [57425] (2 proteins) Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57427] (10 PDB entries) 
Domain d1n7da9: 1n7d A:212-251 [80244]
Other proteins in same PDB: d1n7da1, d1n7da2, d1n7da3, d1n7da4
Details for d1n7da9
PDB Entry: 1n7d (more details), 3.7 Å
PDB Description: extracellular domain of the ldl receptor
SCOP Domain Sequences for d1n7da9:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n7da9 g.12.1.1 (A:212-251) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens)}
vatcrpdefqcsdgncihgsrqcdreydckdmsdevgcvn
SCOP Domain Coordinates for d1n7da9:
Click to download the PDB-style file with coordinates for d1n7da9.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n7da9:
- d1n7da9 is new in SCOP 1.63
- d1n7da9 appears in SCOP 1.65
- d1n7da9 appears in the current release, SCOPe 2.08
View in 3D
