Class g: Small proteins [56992] (90 folds) |
Fold g.12: LDL receptor-like module [57423] (1 superfamily) disulfide-rich calcium-binding fold |
Superfamily g.12.1: LDL receptor-like module [57424] (1 family) |
Family g.12.1.1: LDL receptor-like module [57425] (6 proteins) |
Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57427] (12 PDB entries) Uniprot P01130 272-353 |
Domain d1n7da5: 1n7d A:44-83 [80240] Other proteins in same PDB: d1n7da1, d1n7da2, d1n7da3, d1n7da4 all but the first modules in the whole receptor structure context complexed with ca, keg |
PDB Entry: 1n7d (more details), 3.7 Å
SCOPe Domain Sequences for d1n7da5:
Sequence, based on SEQRES records: (download)
>d1n7da5 g.12.1.1 (A:44-83) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} svtcksgdfscggrvnrcipqfwrcdgqvdcdngsdeqgc
>d1n7da5 g.12.1.1 (A:44-83) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} svtcksgdfscggnrcipqfwrcdgqvdcngsdeqgc
Timeline for d1n7da5: