Lineage for d1n7da5 (1n7d A:44-83)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623101Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 623102Superfamily g.12.1: LDL receptor-like module [57424] (1 family) (S)
  5. 623103Family g.12.1.1: LDL receptor-like module [57425] (3 proteins)
  6. 623104Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 623105Species Human (Homo sapiens) [TaxId:9606] [57427] (11 PDB entries)
  8. 623117Domain d1n7da5: 1n7d A:44-83 [80240]
    Other proteins in same PDB: d1n7da1, d1n7da2, d1n7da3, d1n7da4

Details for d1n7da5

PDB Entry: 1n7d (more details), 3.7 Å

PDB Description: extracellular domain of the ldl receptor

SCOP Domain Sequences for d1n7da5:

Sequence, based on SEQRES records: (download)

>d1n7da5 g.12.1.1 (A:44-83) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens)}
svtcksgdfscggrvnrcipqfwrcdgqvdcdngsdeqgc

Sequence, based on observed residues (ATOM records): (download)

>d1n7da5 g.12.1.1 (A:44-83) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens)}
svtcksgdfscggnrcipqfwrcdgqvdcngsdeqgc

SCOP Domain Coordinates for d1n7da5:

Click to download the PDB-style file with coordinates for d1n7da5.
(The format of our PDB-style files is described here.)

Timeline for d1n7da5: